Lineage for d1dv2a1 (1dv2 A:331-447)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2426781Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2426884Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 2426885Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
    probable rudiment form of the biotinyl-carrier domain
  6. 2426892Protein Biotin carboxylase (BC), C-domain [51248] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 2426895Species Escherichia coli [TaxId:562] [51249] (24 PDB entries)
  8. 2426945Domain d1dv2a1: 1dv2 A:331-447 [28238]
    Other proteins in same PDB: d1dv2a2, d1dv2a3, d1dv2a4, d1dv2b2, d1dv2b3, d1dv2b4
    complexed with atp; mutant

Details for d1dv2a1

PDB Entry: 1dv2 (more details), 2.5 Å

PDB Description: the structure of biotin carboxylase, mutant e288k, complexed with atp
PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d1dv2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dv2a1 b.84.2.1 (A:331-447) Biotin carboxylase (BC), C-domain {Escherichia coli [TaxId: 562]}
rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklglq

SCOPe Domain Coordinates for d1dv2a1:

Click to download the PDB-style file with coordinates for d1dv2a1.
(The format of our PDB-style files is described here.)

Timeline for d1dv2a1: