PDB entry 1dv2

View 1dv2 on RCSB PDB site
Description: The structure of biotin carboxylase, mutant E288K, complexed with ATP
Class: ligase
Keywords: ATP-grasp biotin-dependent carboxylase, LIGASE
Deposited on 2000-01-19, released 2000-06-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.172
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: biotin carboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24182 (3-End)
      • inserted (3)
      • inserted (3)
      • inserted (3)
      • mutation (290)
    Domains in SCOPe 2.06: d1dv2a1, d1dv2a2, d1dv2a3, d1dv2a4
  • Chain 'B':
    Compound: biotin carboxylase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24182 (3-End)
      • inserted (3)
      • inserted (3)
      • inserted (3)
      • mutation (290)
    Domains in SCOPe 2.06: d1dv2b1, d1dv2b2, d1dv2b3, d1dv2b4
  • Heterogens: ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dv2A (A:)
    gshmldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsv
    ksylnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmgdkv
    saiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrgdae
    laqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqrrhq
    kvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfikmntriqveh
    pvtemitgvdlikeqlriaagqplsikqeevhvrghavecrinaedpntflpspgkitrf
    hapggfgvrweshiyagytvppyydsmigklicygenrdvaiarmknalqeliidgiktn
    vdlqirimndenfqhggtnihylekklglqek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dv2A (A:)
    gshmldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsv
    ksylnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmgdkv
    saiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrgdae
    laqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqrrhq
    kvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfikmntriqveh
    pvtemitgvdlikeqlriaagqplsikqeevhvrghavecrinaedpntflpspgkitrf
    hapggfgvrweshiyagytvppyydsmigklicygenrdvaiarmknalqeliidgiktn
    vdlqirimndenfqhggtnihylekklglq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dv2B (B:)
    gshmldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsv
    ksylnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmgdkv
    saiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrgdae
    laqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqrrhq
    kvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfikmntriqveh
    pvtemitgvdlikeqlriaagqplsikqeevhvrghavecrinaedpntflpspgkitrf
    hapggfgvrweshiyagytvppyydsmigklicygenrdvaiarmknalqeliidgiktn
    vdlqirimndenfqhggtnihylekklglqek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dv2B (B:)
    hmldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvks
    ylnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmgdkvsa
    iaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrgdaela
    qsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqrrhqkv
    veeapapgitpelrryigercakacvdigyrgagtfeflfengefyfikmntriqvehpv
    temitgvdlikeqlriaagqplsikqeevhvrghavecrinaedpntflpspgkitrfha
    pggfgvrweshiyagytvppyydsmigklicygenrdvaiarmknalqeliidgiktnvd
    lqirimndenfqhggtnihylekklglq