Lineage for d1qg0b2 (1qg0 B:1154-1308)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22422Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
  4. 22423Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
  5. 22424Family c.25.1.1: Reductases [52344] (4 proteins)
  6. 22428Protein Ferredoxin reductase (flavodoxin reductase) [52345] (7 species)
  7. 22440Species Garden pea (Pisum sativum) [TaxId:3888] [52347] (4 PDB entries)
  8. 22448Domain d1qg0b2: 1qg0 B:1154-1308 [31530]
    Other proteins in same PDB: d1qg0a1, d1qg0b1

Details for d1qg0b2

PDB Entry: 1qg0 (more details), 2.5 Å

PDB Description: wild-type pea fnr

SCOP Domain Sequences for d1qg0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qg0b2 c.25.1.1 (B:1154-1308) Ferredoxin reductase (flavodoxin reductase) {Garden pea (Pisum sativum)}
dpnatvimlgtgtgiapfrsflwkmffekhedyqfnglawlflgvptsssllykeefekm
kekapenfrldfavsreqvndkgekmyiqtrmaqyaeelwellkkdntfvymcglkgmek
giddimvslaakdgidwieykrtlkkaeqwnvevy

SCOP Domain Coordinates for d1qg0b2:

Click to download the PDB-style file with coordinates for d1qg0b2.
(The format of our PDB-style files is described here.)

Timeline for d1qg0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qg0b1