Lineage for d1qg0b2 (1qg0 B:1154-1308)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2859730Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2859731Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2859732Family c.25.1.1: Reductases [52344] (5 proteins)
  6. 2859751Protein Ferredoxin reductase (flavodoxin reductase) [52345] (9 species)
  7. 2859789Species Pea (Pisum sativum) [TaxId:3888] [52347] (4 PDB entries)
  8. 2859797Domain d1qg0b2: 1qg0 B:1154-1308 [31530]
    Other proteins in same PDB: d1qg0a1, d1qg0b1
    complexed with fad

Details for d1qg0b2

PDB Entry: 1qg0 (more details), 2.5 Å

PDB Description: wild-type pea fnr
PDB Compounds: (B:) protein (ferredoxin:nadp+ reductase)

SCOPe Domain Sequences for d1qg0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qg0b2 c.25.1.1 (B:1154-1308) Ferredoxin reductase (flavodoxin reductase) {Pea (Pisum sativum) [TaxId: 3888]}
dpnatvimlgtgtgiapfrsflwkmffekhedyqfnglawlflgvptsssllykeefekm
kekapenfrldfavsreqvndkgekmyiqtrmaqyaeelwellkkdntfvymcglkgmek
giddimvslaakdgidwieykrtlkkaeqwnvevy

SCOPe Domain Coordinates for d1qg0b2:

Click to download the PDB-style file with coordinates for d1qg0b2.
(The format of our PDB-style files is described here.)

Timeline for d1qg0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qg0b1