SCOP 1.55: Domain d1qfzb2: 1qfz B:654-808

Lineage for d1qfzb2 (1qfz B:654-808)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families)

5. Family c.25.1.1: Reductases [52344] (4 proteins)

6. Protein Ferredoxin reductase (flavodoxin reductase) [52345] (7 species)

7. Species Garden pea (Pisum sativum) [TaxId:3888] [52347] (4 PDB entries)

8. Domain d1qfzb2: 1qfz B:654-808 [31524]
   Other proteins in same PDB: d1qfza1, d1qfzb1

Details for d1qfzb2

PDB Entry: 1qfz, 1.7 Å

PDB Description: pea fnr y308s mutant in complex with nadph

SCOP Domain Sequences for d1qfzb2:

Sequence; same for both SEQRES and ATOM records:

>d1qfzb2 c.25.1.1 (B:654-808) Ferredoxin reductase (flavodoxin reductase) {Garden pea (Pisum sativum)}
dpnatvimlgtgtgiapfrsflwkmffekhedyqfnglawlflgvptsssllykeefekm
kekapenfrldfavsreqvndkgekmyiqtrmaqyaeelwellkkdntfvymcglkgmek
giddimvslaakdgidwieykrtlkkaeqwnvevs

Timeline for d1qfzb2:

• d1qfzb2 appears in SCOP 1.57
  
• d1qfzb2 appears in the current release, SCOPe 2.08