Lineage for d1qfzb2 (1qfz B:654-808)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 68846Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
  4. 68847Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) (S)
  5. 68848Family c.25.1.1: Reductases [52344] (4 proteins)
  6. 68852Protein Ferredoxin reductase (flavodoxin reductase) [52345] (8 species)
  7. 68867Species Garden pea (Pisum sativum) [TaxId:3888] [52347] (4 PDB entries)
  8. 68869Domain d1qfzb2: 1qfz B:654-808 [31524]
    Other proteins in same PDB: d1qfza1, d1qfzb1

Details for d1qfzb2

PDB Entry: 1qfz (more details), 1.7 Å

PDB Description: pea fnr y308s mutant in complex with nadph

SCOP Domain Sequences for d1qfzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qfzb2 c.25.1.1 (B:654-808) Ferredoxin reductase (flavodoxin reductase) {Garden pea (Pisum sativum)}
dpnatvimlgtgtgiapfrsflwkmffekhedyqfnglawlflgvptsssllykeefekm
kekapenfrldfavsreqvndkgekmyiqtrmaqyaeelwellkkdntfvymcglkgmek
giddimvslaakdgidwieykrtlkkaeqwnvevs

SCOP Domain Coordinates for d1qfzb2:

Click to download the PDB-style file with coordinates for d1qfzb2.
(The format of our PDB-style files is described here.)

Timeline for d1qfzb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qfzb1