| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
| Family d.17.4.7: Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89851] (2 proteins) automatically mapped to Pfam PF13474 automatically mapped to Pfam PF08332 |
| Protein automated matches [190404] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187282] (4 PDB entries) |
| Domain d5ig3a1: 5ig3 A:345-472 [315172] Other proteins in same PDB: d5ig3a2, d5ig3b2, d5ig3c2, d5ig3d2, d5ig3e2, d5ig3f2 automated match to d1hkxe_ |
PDB Entry: 5ig3 (more details), 2.75 Å
SCOPe Domain Sequences for d5ig3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ig3a1 d.17.4.7 (A:345-472) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyfenlws
rnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrdgkwqi
vhfhrsga
Timeline for d5ig3a1: