SCOPe 2.06: Domain d5ig3a1: 5ig3 A:345-472

Lineage for d5ig3a1 (5ig3 A:345-472)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.7: Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89851] (2 proteins)
   automatically mapped to Pfam PF13474
   automatically mapped to Pfam PF08332

6. Protein automated matches [190404] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187282] (3 PDB entries)

8. Domain d5ig3a1: 5ig3 A:345-472 [315172]
   Other proteins in same PDB: d5ig3a2, d5ig3b2, d5ig3c2, d5ig3d2, d5ig3e2, d5ig3f2
   automated match to d1hkxe_

Details for d5ig3a1

PDB Entry: 5ig3, 2.75 Å

PDB Description: crystal structure of the human camkii-alpha hub

PDB Compounds: (A:) Calcium/calmodulin-dependent protein kinase type II subunit alpha

SCOPe Domain Sequences for d5ig3a1:

Sequence; same for both SEQRES and ATOM records:

>d5ig3a1 d.17.4.7 (A:345-472) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyfenlws
rnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrdgkwqi
vhfhrsga

Timeline for d5ig3a1:

• d5ig3a1 is new in SCOPe 2.06-stable
  
• d5ig3a1 appears in SCOPe 2.07
  
• d5ig3a1 appears in the current release, SCOPe 2.08