PDB entry 5ig3

View 5ig3 on RCSB PDB site
Description: Crystal structure of the human CaMKII-alpha hub
Class: transferase
Keywords: Ca2+/CaM-dependent kinase alpha, hub, TRANSFERASE
Deposited on 2016-02-26, released 2016-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcium/calmodulin-dependent protein kinase type II subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: CAMK2A, CAMKA, KIAA0968
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UQM7 (22-End)
      • expression tag (6-21)
    Domains in SCOPe 2.07: d5ig3a1, d5ig3a2
  • Chain 'B':
    Compound: Calcium/calmodulin-dependent protein kinase type II subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: CAMK2A, CAMKA, KIAA0968
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UQM7 (22-End)
      • expression tag (21)
    Domains in SCOPe 2.07: d5ig3b1, d5ig3b2
  • Chain 'C':
    Compound: Calcium/calmodulin-dependent protein kinase type II subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: CAMK2A, CAMKA, KIAA0968
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UQM7 (22-End)
      • expression tag (8-11)
      • expression tag (20-21)
    Domains in SCOPe 2.07: d5ig3c1, d5ig3c2
  • Chain 'D':
    Compound: Calcium/calmodulin-dependent protein kinase type II subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: CAMK2A, CAMKA, KIAA0968
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UQM7 (22-End)
      • expression tag (8-10)
      • expression tag (21)
    Domains in SCOPe 2.07: d5ig3d1, d5ig3d2
  • Chain 'E':
    Compound: Calcium/calmodulin-dependent protein kinase type II subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: CAMK2A, CAMKA, KIAA0968
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UQM7 (22-End)
      • expression tag (20-21)
    Domains in SCOPe 2.07: d5ig3e1, d5ig3e2
  • Chain 'F':
    Compound: Calcium/calmodulin-dependent protein kinase type II subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: CAMK2A, CAMKA, KIAA0968
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UQM7 (22-End)
      • expression tag (21)
    Domains in SCOPe 2.07: d5ig3f1, d5ig3f2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ig3A (A:)
    gsshhhhhhssglevlfqgphmvrkqeiikvteqlieaisngdfesytkmcdpgmtafep
    ealgnlvegldfhrfyfenlwsrnskpvhttilnphihlmgdesaciayiritqyldagg
    iprtaqseetrvwhrrdgkwqivhfhrsgapsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ig3A (A:)
    hhhssglevlfqgphmvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnl
    vegldfhrfyfenlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaq
    seetrvwhrrdgkwqivhfhrsga
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ig3B (B:)
    gsshhhhhhssglevlfqgphmvrkqeiikvteqlieaisngdfesytkmcdpgmtafep
    ealgnlvegldfhrfyfenlwsrnskpvhttilnphihlmgdesaciayiritqyldagg
    iprtaqseetrvwhrrdgkwqivhfhrsgapsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ig3B (B:)
    mvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyfenlw
    skpvhttilnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrdgkwqivh
    fhrsgap
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ig3C (C:)
    gsshhhhhhssglevlfqgphmvrkqeiikvteqlieaisngdfesytkmcdpgmtafep
    ealgnlvegldfhrfyfenlwsrnskpvhttilnphihlmgdesaciayiritqyldagg
    iprtaqseetrvwhrrdgkwqivhfhrsgapsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ig3C (C:)
    hssghmvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfy
    fenlwsskpvhttilnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrdg
    kwqivhfhrsga
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ig3D (D:)
    gsshhhhhhssglevlfqgphmvrkqeiikvteqlieaisngdfesytkmcdpgmtafep
    ealgnlvegldfhrfyfenlwsrnskpvhttilnphihlmgdesaciayiritqyldagg
    iprtaqseetrvwhrrdgkwqivhfhrsgapsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ig3D (D:)
    hssmvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyfe
    nlpvhttilnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrdgkwqivh
    fhrsgap
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ig3E (E:)
    gsshhhhhhssglevlfqgphmvrkqeiikvteqlieaisngdfesytkmcdpgmtafep
    ealgnlvegldfhrfyfenlwsrnskpvhttilnphihlmgdesaciayiritqyldagg
    iprtaqseetrvwhrrdgkwqivhfhrsgapsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ig3E (E:)
    hmvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyfenl
    pvhttilnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrdgkwqivhfh
    rsgap
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5ig3F (F:)
    gsshhhhhhssglevlfqgphmvrkqeiikvteqlieaisngdfesytkmcdpgmtafep
    ealgnlvegldfhrfyfenlwsrnskpvhttilnphihlmgdesaciayiritqyldagg
    iprtaqseetrvwhrrdgkwqivhfhrsgapsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ig3F (F:)
    mvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyfenkp
    vhttilnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrdgkwqivhfhr
    sga