Lineage for d5ig3b1 (5ig3 B:345-473)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2543372Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2543869Family d.17.4.7: Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89851] (2 proteins)
    automatically mapped to Pfam PF13474
    automatically mapped to Pfam PF08332
  6. 2543890Protein automated matches [190404] (2 species)
    not a true protein
  7. 2543891Species Human (Homo sapiens) [TaxId:9606] [187282] (4 PDB entries)
  8. 2543919Domain d5ig3b1: 5ig3 B:345-473 [315336]
    Other proteins in same PDB: d5ig3a2, d5ig3b2, d5ig3c2, d5ig3d2, d5ig3e2, d5ig3f2
    automated match to d1hkxe_

Details for d5ig3b1

PDB Entry: 5ig3 (more details), 2.75 Å

PDB Description: crystal structure of the human camkii-alpha hub
PDB Compounds: (B:) Calcium/calmodulin-dependent protein kinase type II subunit alpha

SCOPe Domain Sequences for d5ig3b1:

Sequence, based on SEQRES records: (download)

>d5ig3b1 d.17.4.7 (B:345-473) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyfenlws
rnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrdgkwqi
vhfhrsgap

Sequence, based on observed residues (ATOM records): (download)

>d5ig3b1 d.17.4.7 (B:345-473) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlvegldfhrfyfenlws
kpvhttilnphihlmgdesaciayiritqyldaggiprtaqseetrvwhrrdgkwqivhf
hrsgap

SCOPe Domain Coordinates for d5ig3b1:

Click to download the PDB-style file with coordinates for d5ig3b1.
(The format of our PDB-style files is described here.)

Timeline for d5ig3b1: