![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
![]() | Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) ![]() Similar in architecture to the superfamily II but partly differs in topology |
![]() | Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins) has additional insertions and/or extensions that are not grouped together |
![]() | Protein automated matches [190296] (11 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [267861] (7 PDB entries) |
![]() | Domain d5fwya_: 5fwy A: [314562] Other proteins in same PDB: d5fwyb2 automated match to d3hsyb_ complexed with gol, nag, so4 |
PDB Entry: 5fwy (more details), 2.12 Å
SCOPe Domain Sequences for d5fwya_:
Sequence, based on SEQRES records: (download)
>d5fwya_ c.93.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfgganvsgfqivd yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrr gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr kigywsevdkmvvt
>d5fwya_ c.93.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfgganvsgfqivd yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisra gdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngprkig ywsevdkmvvt
Timeline for d5fwya_:
![]() Domains from other chains: (mouse over for more information) d5fwyb1, d5fwyb2, d5fwyc_, d5fwyd_ |