Lineage for d5fwya_ (5fwy A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520303Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2520304Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2520305Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
  6. 2520549Protein automated matches [190296] (11 species)
    not a true protein
  7. 2520579Species Norway rat (Rattus norvegicus) [TaxId:10116] [267861] (7 PDB entries)
  8. 2520588Domain d5fwya_: 5fwy A: [314562]
    Other proteins in same PDB: d5fwyb2
    automated match to d3hsyb_
    complexed with gol, nag, so4

Details for d5fwya_

PDB Entry: 5fwy (more details), 2.12 Å

PDB Description: crystal structure of the ampa receptor glua2/a3 n-terminal domain heterodimer
PDB Compounds: (A:) Glutamate receptor 2

SCOPe Domain Sequences for d5fwya_:

Sequence, based on SEQRES records: (download)

>d5fwya_ c.93.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke
rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfgganvsgfqivd
yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrr
gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr
kigywsevdkmvvt

Sequence, based on observed residues (ATOM records): (download)

>d5fwya_ c.93.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke
rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfgganvsgfqivd
yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisra
gdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngprkig
ywsevdkmvvt

SCOPe Domain Coordinates for d5fwya_:

Click to download the PDB-style file with coordinates for d5fwya_.
(The format of our PDB-style files is described here.)

Timeline for d5fwya_: