PDB entry 5fwy

View 5fwy on RCSB PDB site
Description: Crystal structure of the AMPA receptor GluA2/A3 N-terminal domain heterodimer
Class: transport protein
Keywords: transport protein
Deposited on 2016-02-21, released 2016-03-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5fwya_
  • Chain 'B':
    Compound: Glutamate receptor 3
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19492 (Start-380)
      • expression tag (381)
    Domains in SCOPe 2.08: d5fwyb1, d5fwyb2
  • Chain 'C':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5fwyc_
  • Chain 'D':
    Compound: Glutamate receptor 3
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5fwyd_
  • Heterogens: NAG, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5fwyA (A:)
    nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
    vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
    wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke
    rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfgganvsgfqivd
    yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrr
    gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr
    kigywsevdkmvvtltrtkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fwyA (A:)
    nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
    vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
    wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke
    rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfgganvsgfqivd
    yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisra
    gdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngprkig
    ywsevdkmvvt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5fwyB (B:)
    gfpntisigglfmrntvqehsafrfavqlyntnqnttekpfhlnyhvdhldssnsfsvtn
    afcsqfsrgvyaifgfydqmsmntltsfcgalhtsfvtpsfptdadvqfviqmrpalkga
    ilsllsyykwekfvylydtergfsvlqaimeaavqnnwqvtarsvgnikdvqefrriiee
    mdrrqekrylidceverintileqvvilgkhsrgyhymlanlgftdillervmhgganit
    gfqivnnenpmvqqfiqrwvrlderefpeaknaplkytsalthdailviaeafrylrrqr
    vdvsrrgsagdclanpavpwsqgidieralkmvqvqgmtgniqfdtygrrtnytidvyem
    kvsgsrkagywneyerfvpfsgtkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fwyB (B:)
    fpntisigglfmrntvqehsafrfavqlyntnqnttekpfhlnyhvdhldssnsfsvtna
    fcsqfsrgvyaifgfydqmsmntltsfcgalhtsfvtpsfptdadvqfviqmrpalkgai
    lsllsyykwekfvylydtergfsvlqaimeaavqnnwqvtarsvgnikdvqefrriieem
    drrqekrylidceverintileqvvilgkhsrgyhymlanlgftdillervmhgganitg
    fqivnnenpmvqqfiqrwvrlderefpeaknaplkytsalthdailviaeafrylrrqrv
    dvsrrgsagdclanpavpwsqgidieralkmvqvqgmtgniqfdtygrrtnytidvyemk
    gsrkagywneyerfvpfsg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5fwyC (C:)
    nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
    vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
    wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdetyrslfqdlelkke
    rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfgganvsgfqivd
    yddslvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrr
    gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr
    kigywsevdkmvvtltrtkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fwyC (C:)
    nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
    vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
    wdkfaylydsdrglstlqavldsaaekkwqvtainvgnikkdetyrslfqdlelkkerrv
    ildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfgganvsgfqivdydd
    slvskfierwstleekeypgahtatikytsaltydavqvmteafrnlrkqrieisrgdcl
    anpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngprkigywse
    vdkmvvt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5fwyD (D:)
    gfpntisigglfmrntvqehsafrfavqlyntnqnttekpfhlnyhvdhldssnsfsvtn
    afcsqfsrgvyaifgfydqmsmntltsfcgalhtsfvtpsfptdadvqfviqmrpalkga
    ilsllsyykwekfvylydtergfsvlqaimeaavqnnwqvtarsvgnikdvqefrriiee
    mdrrqekrylidceverintileqvvilgkhsrgyhymlanlgftdillervmhgganit
    gfqivnnenpmvqqfiqrwvrlderefpeaknaplkytsalthdailviaeafrylrrqr
    vdvsrrgsagdclanpavpwsqgidieralkmvqvqgmtgniqfdtygrrtnytidvyem
    kvsgsrkagywneyerfvpfsgtkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5fwyD (D:)
    fpntisigglfmrntvqehsafrfavqlyntnqnttekpfhlnyhvdhldssnsfsvtna
    fcsqfsrgvyaifgfydqmsmntltsfcgalhtsfvtpsfptdadvqfviqmrpalkgai
    lsllsyykwekfvylydtergfsvlqaimeaavqnnwqvtarsvgnikdvqefrriieem
    drrqekrylidceverintileqvvilgkhsrgyhymlanlgftdillervmhgganitg
    fqivnnenpmvqqfiqrwvrlderefpeaaplkytsalthdailviaeafrylrrqrvdv
    srrgsagdclanpavpwsqgidieralkmvqvqgmtgniqfdtygrrtnytidvyemkvs
    gsrkagywneyerfvpf