| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
| Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins) contains a catalytic triad or dyad different from the class I GAT triad |
| Protein Intracellular protease [52326] (3 species) |
| Species Pyrococcus horikoshii [TaxId:53953] [52327] (3 PDB entries) |
| Domain d1g2ib_: 1g2i B: [31439] complexed with so4 |
PDB Entry: 1g2i (more details), 2 Å
SCOPe Domain Sequences for d1g2ib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g2ib_ c.23.16.2 (B:) Intracellular protease {Pyrococcus horikoshii [TaxId: 53953]}
mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk
Timeline for d1g2ib_: