PDB entry 1g2i

View 1g2i on RCSB PDB site
Description: crystal structure of a novel intracellular protease from pyrococcus horikoshii at 2 a resolution
Class: hydrolase
Keywords: intracellular protease, ATP-independent intracellular protease, protease, catalytical triad, PfpI, cysteine protease, nucleophile elbow, Structural Genomics, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center, HYDROLASE
Deposited on 2000-10-19, released 2000-11-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protease I
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1704
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59413
      • modified residue (0)
      • modified residue (88)
      • modified residue (126)
      • modified residue (157)
    Domains in SCOPe 2.08: d1g2ia_
  • Chain 'B':
    Compound: protease I
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1704
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59413
      • modified residue (0)
      • modified residue (88)
      • modified residue (126)
      • modified residue (157)
    Domains in SCOPe 2.08: d1g2ib_
  • Chain 'C':
    Compound: protease I
    Species: Pyrococcus horikoshii [TaxId:53953]
    Gene: PH1704
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59413 (0-165)
      • modified residue (0)
      • modified residue (88)
      • modified residue (126)
      • modified residue (157)
    Domains in SCOPe 2.08: d1g2ic_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g2iA (A:)
    mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
    efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
    pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g2iB (B:)
    mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
    efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
    pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g2iC (C:)
    mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
    efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
    pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk