PDB entry 1g2i
View 1g2i on RCSB PDB site
Description: crystal structure of a novel intracellular protease from pyrococcus horikoshii at 2 a resolution
Class: hydrolase
Keywords: intracellular protease, ATP-independent intracellular protease, protease, catalytical triad, PfpI, cysteine protease, nucleophile elbow, Structural Genomics, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center, HYDROLASE
Deposited on
2000-10-19, released
2000-11-08
The last revision prior to the SCOPe 2.08 freeze date was dated
2018-01-24, with a file datestamp of
2018-01-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protease I
Species: Pyrococcus horikoshii [TaxId:53953]
Gene: PH1704
Database cross-references and differences (RAF-indexed):
- Uniprot O59413
- modified residue (0)
- modified residue (88)
- modified residue (126)
- modified residue (157)
Domains in SCOPe 2.08: d1g2ia_ - Chain 'B':
Compound: protease I
Species: Pyrococcus horikoshii [TaxId:53953]
Gene: PH1704
Database cross-references and differences (RAF-indexed):
- Uniprot O59413
- modified residue (0)
- modified residue (88)
- modified residue (126)
- modified residue (157)
Domains in SCOPe 2.08: d1g2ib_ - Chain 'C':
Compound: protease I
Species: Pyrococcus horikoshii [TaxId:53953]
Gene: PH1704
Database cross-references and differences (RAF-indexed):
- Uniprot O59413 (0-165)
- modified residue (0)
- modified residue (88)
- modified residue (126)
- modified residue (157)
Domains in SCOPe 2.08: d1g2ic_ - Heterogens: SO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1g2iA (A:)
mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1g2iB (B:)
mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1g2iC (C:)
mkvlfltanefedveliypyhrlkeeghevyiasfergtitgkhgysvkvdltfdkvnpe
efdalvlpggrapervrlnekavsiarkmfsegkpvasichgpqilisagvlrgrkgtsy
pgikddminagvewvdaevvvdgnwvssrvpadlyawmrefvkllk