Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology automatically mapped to Pfam PF02776 |
Protein Acetohydroxyacid synthase catalytic subunit [88733] (3 species) |
Species Saccharomyces cerevisiae [TaxId:559292] [314106] (2 PDB entries) |
Domain d5fema1: 5fem A:83-270 [314121] Other proteins in same PDB: d5fema2, d5fema3, d5femb2, d5femb3 automated match to d1n0ha2 complexed with 60g, fad, mg, tpp |
PDB Entry: 5fem (more details), 2.17 Å
SCOPe Domain Sequences for d5fema1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fema1 c.36.1.5 (A:83-270) Acetohydroxyacid synthase catalytic subunit {Saccharomyces cerevisiae [TaxId: 559292]} pdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqga ghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdafq eadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnpi ptkttlps
Timeline for d5fema1: