Lineage for d5femb1 (5fem B:83-270)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122269Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2122270Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2122271Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
    automatically mapped to Pfam PF02776
  6. 2122272Protein Acetohydroxyacid synthase catalytic subunit [88733] (3 species)
  7. 2122296Species Saccharomyces cerevisiae [TaxId:559292] [314106] (2 PDB entries)
  8. 2122300Domain d5femb1: 5fem B:83-270 [314107]
    Other proteins in same PDB: d5fema2, d5fema3, d5femb2, d5femb3
    automated match to d1n0ha2
    complexed with 60g, fad, mg, tpp

Details for d5femb1

PDB Entry: 5fem (more details), 2.17 Å

PDB Description: saccharomyces cerevisiae acetohydroxyacid synthase in complex with bensulfuron methyl
PDB Compounds: (B:) Acetolactate synthase catalytic subunit, mitochondrial

SCOPe Domain Sequences for d5femb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5femb1 c.36.1.5 (B:83-270) Acetohydroxyacid synthase catalytic subunit {Saccharomyces cerevisiae [TaxId: 559292]}
pdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqga
ghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdafq
eadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnpi
ptkttlps

SCOPe Domain Coordinates for d5femb1:

Click to download the PDB-style file with coordinates for d5femb1.
(The format of our PDB-style files is described here.)

Timeline for d5femb1: