Lineage for d5femb2 (5fem B:277-460)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121033Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2121034Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2121061Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 2121062Protein Acetohydroxyacid synthase catalytic subunit [69463] (3 species)
  7. 2121086Species Saccharomyces cerevisiae [TaxId:559292] [314108] (2 PDB entries)
  8. 2121090Domain d5femb2: 5fem B:277-460 [314109]
    Other proteins in same PDB: d5fema1, d5fema3, d5femb1, d5femb3
    automated match to d1n0ha1
    complexed with 60g, fad, mg, tpp

Details for d5femb2

PDB Entry: 5fem (more details), 2.17 Å

PDB Description: saccharomyces cerevisiae acetohydroxyacid synthase in complex with bensulfuron methyl
PDB Compounds: (B:) Acetolactate synthase catalytic subunit, mitochondrial

SCOPe Domain Sequences for d5femb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5femb2 c.31.1.3 (B:277-460) Acetohydroxyacid synthase catalytic subunit {Saccharomyces cerevisiae [TaxId: 559292]}
tsraqdefvmqsinkaadlinlakkpvlyvgagilnhadgprllkelsdraqipvtttlq
glgsfdqedpksldmlgmhgcatanlavqnadliiavgarfddrvtgniskfapearraa
aegrggiihfevspkninkvvqtqiavegdattnlgkmmskifpvkersewfaqinkwkk
eypy

SCOPe Domain Coordinates for d5femb2:

Click to download the PDB-style file with coordinates for d5femb2.
(The format of our PDB-style files is described here.)

Timeline for d5femb2: