Lineage for d1dx9b_ (1dx9 B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 
Superfamily c.23.5: Flavoproteins [52218] (3 families) 
Family c.23.5.1: Flavodoxin-related [52219] (3 proteins) Protein Flavodoxin [52220] (6 species) Species Anabaena, pcc 7119 and 7120 [TaxId:1163] [52223] (5 PDB entries) 
Domain d1dx9b_: 1dx9 B: [31172]
Details for d1dx9b_
PDB Entry: 1dx9 (more details), 2.05 Å
PDB Description: w57a apoflavodoxin from anabaena
SCOP Domain Sequences for d1dx9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dx9b_ c.23.5.1 (B:) Flavodoxin {Anabaena, pcc 7119 and 7120}
kkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptanige
lqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyws
tdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl
SCOP Domain Coordinates for d1dx9b_:
Click to download the PDB-style file with coordinates for d1dx9b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1dx9b_:
- d1dx9b_ appears in SCOP 1.57
- d1dx9b_ appears in the current release, SCOPe 2.08
View in 3D
