Lineage for d1dx9a_ (1dx9 A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 21933Superfamily c.23.5: Flavoproteins [52218] (3 families) (S)
  5. 21934Family c.23.5.1: Flavodoxin-related [52219] (3 proteins)
  6. 21935Protein Flavodoxin [52220] (6 species)
  7. 21936Species Anabaena, pcc 7119 and 7120 [TaxId:1163] [52223] (5 PDB entries)
  8. 21938Domain d1dx9a_: 1dx9 A: [31171]

Details for d1dx9a_

PDB Entry: 1dx9 (more details), 2.05 Å

PDB Description: w57a apoflavodoxin from anabaena

SCOP Domain Sequences for d1dx9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dx9a_ c.23.5.1 (A:) Flavodoxin {Anabaena, pcc 7119 and 7120}
kkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptanige
lqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyws
tdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl

SCOP Domain Coordinates for d1dx9a_:

Click to download the PDB-style file with coordinates for d1dx9a_.
(The format of our PDB-style files is described here.)

Timeline for d1dx9a_: