Lineage for d1cqia2 (1cqi A:122-286)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856236Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) (S)
  5. 2856237Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 2856244Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (6 species)
  7. 2856247Species Escherichia coli [TaxId:562] [52213] (11 PDB entries)
  8. 2856270Domain d1cqia2: 1cqi A:122-286 [31137]
    Other proteins in same PDB: d1cqia1, d1cqib1, d1cqib2, d1cqid1, d1cqie1, d1cqie2
    complexed with adp, coa, mg, po4

Details for d1cqia2

PDB Entry: 1cqi (more details), 3.3 Å

PDB Description: crystal structure of the complex of adp and mg2+ with dephosphorylated e. coli succinyl-coa synthetase
PDB Compounds: (A:) protein (succinyl-coa synthetase alpha chain)

SCOPe Domain Sequences for d1cqia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cqia2 c.23.4.1 (A:122-286) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
ncpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggdp
ipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapkg
krmghagaiiaggkgtadekfaaleaagvktvrsladigealktv

SCOPe Domain Coordinates for d1cqia2:

Click to download the PDB-style file with coordinates for d1cqia2.
(The format of our PDB-style files is described here.)

Timeline for d1cqia2: