![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) ![]() |
![]() | Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins) contain additional N-terminal strand "0", antiparallel to strand 2 |
![]() | Protein Succinyl-CoA synthetase, beta-chain, C-terminal domain [52215] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [52216] (11 PDB entries) |
![]() | Domain d1cqib1: 1cqi B:239-385 [31147] Other proteins in same PDB: d1cqia1, d1cqia2, d1cqib2, d1cqid1, d1cqid2, d1cqie2 complexed with adp, coa, mg, po4 |
PDB Entry: 1cqi (more details), 3.3 Å
SCOPe Domain Sequences for d1cqib1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cqib1 c.23.4.1 (B:239-385) Succinyl-CoA synthetase, beta-chain, C-terminal domain {Escherichia coli [TaxId: 562]} dpreaqaaqwelnyvaldgnigcmvngaglamgtmdivklhggepanfldvgggatkerv teafkiilsddkvkavlvnifggivrcdliadgiigavaevgvnvpvvvrlegnnaelga kkladsglniiaakgltdaaqqvvaav
Timeline for d1cqib1: