Lineage for d1cqib2 (1cqi B:1-238)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2978768Family d.142.1.4: Succinyl-CoA synthetase, beta-chain, N-terminal domain [56081] (1 protein)
    automatically mapped to Pfam PF13549
    automatically mapped to Pfam PF08442
  6. 2978769Protein Succinyl-CoA synthetase, beta-chain, N-terminal domain [56082] (3 species)
  7. 2978770Species Escherichia coli [TaxId:562] [56083] (11 PDB entries)
  8. 2978793Domain d1cqib2: 1cqi B:1-238 [41568]
    Other proteins in same PDB: d1cqia1, d1cqia2, d1cqib1, d1cqid1, d1cqid2, d1cqie1
    complexed with adp, coa, mg, po4

Details for d1cqib2

PDB Entry: 1cqi (more details), 3.3 Å

PDB Description: crystal structure of the complex of adp and mg2+ with dephosphorylated e. coli succinyl-coa synthetase
PDB Compounds: (B:) protein (succinyl-coa synthetase beta chain)

SCOPe Domain Sequences for d1cqib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cqib2 d.142.1.4 (B:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli [TaxId: 562]}
mnlheyqakqlfaryglpapvgyacttpreaeeaaskigagpwvvkcqvhaggrgkaggv
kvvnskedirafaenwlgkrlvtyqtdangqpvnqilveaatdiakelylgavvdrssrr
vvfmasteggveiekvaeetphlihkvaldpltgpmpyqgrelafklglegklvqqftki
fmglatiflerdlalieinplvitkqgdlicldgklgadgnalfrqpdlremrdqsqe

SCOPe Domain Coordinates for d1cqib2:

Click to download the PDB-style file with coordinates for d1cqib2.
(The format of our PDB-style files is described here.)

Timeline for d1cqib2: