Lineage for d1cqia2 (1cqi A:122-286)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 21905Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family) (S)
  5. 21906Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (2 proteins)
  6. 21907Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (2 species)
  7. 21908Species Escherichia coli [TaxId:562] [52213] (4 PDB entries)
  8. 21915Domain d1cqia2: 1cqi A:122-286 [31137]
    Other proteins in same PDB: d1cqia1, d1cqib1, d1cqib2, d1cqid1, d1cqie1, d1cqie2

Details for d1cqia2

PDB Entry: 1cqi (more details), 3.3 Å

PDB Description: crystal structure of the complex of adp and mg2+ with dephosphorylated e. coli succinyl-coa synthetase

SCOP Domain Sequences for d1cqia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cqia2 c.23.4.1 (A:122-286) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Escherichia coli}
ncpgvitpgeckigiqpghihkpgkvgivsrsgtltyeavkqttdygfgqstcvgiggdp
ipgsnfidilemfekdpqteaivmigeiggsaeeeaaayikehvtkpvvgyiagvtapkg
krmghagaiiaggkgtadekfaaleaagvktvrsladigealktv

SCOP Domain Coordinates for d1cqia2:

Click to download the PDB-style file with coordinates for d1cqia2.
(The format of our PDB-style files is described here.)

Timeline for d1cqia2: