![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.29: Photosystem I subunits PsaA/PsaB [81559] (1 superfamily) core:11 transmembrane helices |
![]() | Superfamily f.29.1: Photosystem I subunits PsaA/PsaB [81558] (2 families) ![]() automatically mapped to Pfam PF00223 |
![]() | Family f.29.1.1: Photosystem I subunits PsaA/PsaB [81557] (3 proteins) Photosystem I p700 chlorophyll a apoprotein a1/a2 |
![]() | Protein automated matches [236561] (10 species) not a true protein |
![]() | Species Pea (Pisum sativum) [TaxId:3888] [276242] (9 PDB entries) |
![]() | Domain d4xk8b_: 4xk8 B: [310034] Other proteins in same PDB: d4xk81_, d4xk82_, d4xk83_, d4xk84_, d4xk86_, d4xk87_, d4xk88_, d4xk89_, d4xk8c_, d4xk8d_, d4xk8e_, d4xk8f_, d4xk8j_ automated match to d4y28b_ complexed with bcr, chl, cla, dgd, htg, lhg, lmg, lmt, lut, pqn, sf4, xat |
PDB Entry: 4xk8 (more details), 2.8 Å
SCOPe Domain Sequences for d4xk8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xk8b_ f.29.1.1 (B:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} alrfprfsqgiaqdpttrriwfgiatahdfeshdditegrlyqnifashfgqlaiiflwt sgnlfhvawqgnfeawvqdpfhvrpiahaiwdphfgqpaveaftrggalgpvnnaysgvy qwwytiglrtnedlytgaifllflsfisllagwlhlqpkwkpsvswfknaesrlnhhlsg lfgvsslawaghlvhvaipgsrgeyvrwnnfldvlphpqglgplltgqwnlyaqnpsssn hlfgttqgagtailtilggfhpqtqslwltdmahhhlaiaflfligghmyrtnfgighsi kyileahippggrlgrghkglydtinnsihfqlglalaslgvitslvaqhmyslpayafi aqdfttqaalythhqyiagfimtgafahgpiffirdynpeqnadnvlarmlehkeaiish lswaslflgfhtlglyvhndvmlafgtpekqiliepifaqwiqsahgkttygfdvllsst ngpalnagrniwlpgwlnainensnslfltigpgdflvhhaialglhtttlilvkgalda rgsklmpdkkdfgysfpcdgpgrggtcdisawdafylavfwmlntigwvtfywhwkhitl wrgnvsqfnesstylmgwlrdylwlnssqlingynpfgmnslsvwawmflfghlvwatgf mfliswrgywqelietlawahertplanlirwrdkpvalsivqarlvglvhfsvgyifty aafliastsgkfg
Timeline for d4xk8b_: