Lineage for d4xk8c_ (4xk8 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949055Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2949080Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins)
    has C-terminal extension to the common fold
  6. 2949145Protein automated matches [236563] (10 species)
    not a true protein
  7. 2949162Species Pea (Pisum sativum) [TaxId:3888] [276244] (9 PDB entries)
  8. 2949165Domain d4xk8c_: 4xk8 C: [310035]
    Other proteins in same PDB: d4xk81_, d4xk82_, d4xk83_, d4xk84_, d4xk86_, d4xk87_, d4xk88_, d4xk89_, d4xk8a_, d4xk8b_, d4xk8d_, d4xk8e_, d4xk8f_, d4xk8j_
    automated match to d4y28c_
    complexed with bcr, chl, cla, dgd, htg, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d4xk8c_

PDB Entry: 4xk8 (more details), 2.8 Å

PDB Description: crystal structure of plant photosystem i-lhci super-complex at 2.8 angstrom resolution
PDB Compounds: (C:) photosystem I iron-sulfur center

SCOPe Domain Sequences for d4xk8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xk8c_ d.58.1.2 (C:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
shsvkiydtcigctqcvracptdvlemipwggckakqiasaprtedcvgckrcesacptd
flsvrvylwhettrsmglay

SCOPe Domain Coordinates for d4xk8c_:

Click to download the PDB-style file with coordinates for d4xk8c_.
(The format of our PDB-style files is described here.)

Timeline for d4xk8c_: