Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins) has C-terminal extension to the common fold |
Protein automated matches [236563] (10 species) not a true protein |
Species Pea (Pisum sativum) [TaxId:3888] [276244] (9 PDB entries) |
Domain d4xk8c_: 4xk8 C: [310035] Other proteins in same PDB: d4xk81_, d4xk82_, d4xk83_, d4xk84_, d4xk86_, d4xk87_, d4xk88_, d4xk89_, d4xk8a_, d4xk8b_, d4xk8d_, d4xk8e_, d4xk8f_, d4xk8j_ automated match to d4y28c_ complexed with bcr, chl, cla, dgd, htg, lhg, lmg, lmt, lut, pqn, sf4, xat |
PDB Entry: 4xk8 (more details), 2.8 Å
SCOPe Domain Sequences for d4xk8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xk8c_ d.58.1.2 (C:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} shsvkiydtcigctqcvracptdvlemipwggckakqiasaprtedcvgckrcesacptd flsvrvylwhettrsmglay
Timeline for d4xk8c_: