Lineage for d4xk8j_ (4xk8 J:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026183Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families) (S)
    automatically mapped to Pfam PF01701
  5. 3026208Family f.23.18.0: automated matches [276196] (1 protein)
    not a true family
  6. 3026209Protein automated matches [276198] (5 species)
    not a true protein
  7. 3026223Species Pea (Pisum sativum) [TaxId:3888] [276201] (9 PDB entries)
  8. 3026226Domain d4xk8j_: 4xk8 J: [310039]
    Other proteins in same PDB: d4xk81_, d4xk82_, d4xk83_, d4xk84_, d4xk86_, d4xk87_, d4xk88_, d4xk89_, d4xk8a_, d4xk8b_, d4xk8c_, d4xk8d_, d4xk8e_, d4xk8f_
    automated match to d4y28j_
    complexed with bcr, chl, cla, dgd, htg, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d4xk8j_

PDB Entry: 4xk8 (more details), 2.8 Å

PDB Description: crystal structure of plant photosystem i-lhci super-complex at 2.8 angstrom resolution
PDB Compounds: (J:) Photosystem I reaction center subunit IX

SCOPe Domain Sequences for d4xk8j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xk8j_ f.23.18.0 (J:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
mrdlktylsvapvvstlwfgalagllieinrffpdalif

SCOPe Domain Coordinates for d4xk8j_:

Click to download the PDB-style file with coordinates for d4xk8j_.
(The format of our PDB-style files is described here.)

Timeline for d4xk8j_: