![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families) ![]() automatically mapped to Pfam PF01701 |
![]() | Family f.23.18.0: automated matches [276196] (1 protein) not a true family |
![]() | Protein automated matches [276198] (5 species) not a true protein |
![]() | Species Pea (Pisum sativum) [TaxId:3888] [276201] (9 PDB entries) |
![]() | Domain d4xk8j_: 4xk8 J: [310039] Other proteins in same PDB: d4xk81_, d4xk82_, d4xk83_, d4xk84_, d4xk86_, d4xk87_, d4xk88_, d4xk89_, d4xk8a_, d4xk8b_, d4xk8c_, d4xk8d_, d4xk8e_, d4xk8f_ automated match to d4y28j_ complexed with bcr, chl, cla, dgd, htg, lhg, lmg, lmt, lut, pqn, sf4, xat |
PDB Entry: 4xk8 (more details), 2.8 Å
SCOPe Domain Sequences for d4xk8j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xk8j_ f.23.18.0 (J:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} mrdlktylsvapvvstlwfgalagllieinrffpdalif
Timeline for d4xk8j_: