Lineage for d4xk8b_ (4xk8 B:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633135Fold f.29: Photosystem I subunits PsaA/PsaB [81559] (1 superfamily)
    core:11 transmembrane helices
  4. 2633136Superfamily f.29.1: Photosystem I subunits PsaA/PsaB [81558] (2 families) (S)
    automatically mapped to Pfam PF00223
  5. 2633137Family f.29.1.1: Photosystem I subunits PsaA/PsaB [81557] (3 proteins)
    Photosystem I p700 chlorophyll a apoprotein a1/a2
  6. 2633148Protein automated matches [236561] (7 species)
    not a true protein
  7. 2633163Species Pea (Pisum sativum) [TaxId:3888] [276242] (8 PDB entries)
  8. 2633175Domain d4xk8b_: 4xk8 B: [310034]
    Other proteins in same PDB: d4xk81_, d4xk82_, d4xk83_, d4xk84_, d4xk86_, d4xk87_, d4xk88_, d4xk89_, d4xk8c_, d4xk8d_, d4xk8e_, d4xk8f_, d4xk8j_
    automated match to d4y28b_
    complexed with bcr, chl, cla, dgd, htg, lhg, lmg, lmt, lut, pqn, sf4, xat

Details for d4xk8b_

PDB Entry: 4xk8 (more details), 2.8 Å

PDB Description: crystal structure of plant photosystem i-lhci super-complex at 2.8 angstrom resolution
PDB Compounds: (B:) photosystem I p700 chlorophyll a apoprotein a2

SCOPe Domain Sequences for d4xk8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xk8b_ f.29.1.1 (B:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
alrfprfsqgiaqdpttrriwfgiatahdfeshdditegrlyqnifashfgqlaiiflwt
sgnlfhvawqgnfeawvqdpfhvrpiahaiwdphfgqpaveaftrggalgpvnnaysgvy
qwwytiglrtnedlytgaifllflsfisllagwlhlqpkwkpsvswfknaesrlnhhlsg
lfgvsslawaghlvhvaipgsrgeyvrwnnfldvlphpqglgplltgqwnlyaqnpsssn
hlfgttqgagtailtilggfhpqtqslwltdmahhhlaiaflfligghmyrtnfgighsi
kyileahippggrlgrghkglydtinnsihfqlglalaslgvitslvaqhmyslpayafi
aqdfttqaalythhqyiagfimtgafahgpiffirdynpeqnadnvlarmlehkeaiish
lswaslflgfhtlglyvhndvmlafgtpekqiliepifaqwiqsahgkttygfdvllsst
ngpalnagrniwlpgwlnainensnslfltigpgdflvhhaialglhtttlilvkgalda
rgsklmpdkkdfgysfpcdgpgrggtcdisawdafylavfwmlntigwvtfywhwkhitl
wrgnvsqfnesstylmgwlrdylwlnssqlingynpfgmnslsvwawmflfghlvwatgf
mfliswrgywqelietlawahertplanlirwrdkpvalsivqarlvglvhfsvgyifty
aafliastsgkfg

SCOPe Domain Coordinates for d4xk8b_:

Click to download the PDB-style file with coordinates for d4xk8b_.
(The format of our PDB-style files is described here.)

Timeline for d4xk8b_: