Lineage for d4rsud1 (4rsu D:39-97)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034651Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 3034652Superfamily g.24.1: TNF receptor-like [57586] (3 families) (S)
  5. 3034653Family g.24.1.1: TNF receptor-like [57587] (13 proteins)
    Pfam PF00020; TNFR/NGFR cysteine-rich region
  6. 3034769Protein automated matches [227085] (1 species)
    not a true protein
  7. 3034770Species Human (Homo sapiens) [TaxId:9606] [226417] (4 PDB entries)
  8. 3034775Domain d4rsud1: 4rsu D:39-97 [309543]
    Other proteins in same PDB: d4rsua_, d4rsub_, d4rsuc_, d4rsud3, d4rsue3, d4rsuf3, d4rsug_, d4rsuh_, d4rsui_, d4rsuj3, d4rsuk3
    automated match to d1jmab1
    complexed with cl, gol, nag

Details for d4rsud1

PDB Entry: 4rsu (more details), 2.3 Å

PDB Description: crystal structure of the light and hvem complex
PDB Compounds: (D:) Tumor necrosis factor receptor superfamily member 14

SCOPe Domain Sequences for d4rsud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rsud1 g.24.1.1 (D:39-97) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpsckedeypvgseccpkcspgyrvkeacgeltgtvcepcppgtyiahlnglskclqcq

SCOPe Domain Coordinates for d4rsud1:

Click to download the PDB-style file with coordinates for d4rsud1.
(The format of our PDB-style files is described here.)

Timeline for d4rsud1: