| Class b: All beta proteins [48724] (180 folds) |
| Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (2 families) ![]() |
| Family b.22.1.0: automated matches [191519] (1 protein) not a true family |
| Protein automated matches [190873] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188225] (28 PDB entries) |
| Domain d4rsua_: 4rsu A: [309540] Other proteins in same PDB: d4rsud1, d4rsud2, d4rsud3, d4rsue1, d4rsue2, d4rsue3, d4rsuf1, d4rsuf2, d4rsuf3, d4rsuj1, d4rsuj2, d4rsuj3, d4rsuk1, d4rsuk2, d4rsuk3, d4rsul1, d4rsul2 automated match to d2re9a_ complexed with cl, gol, nag |
PDB Entry: 4rsu (more details), 2.3 Å
SCOPe Domain Sequences for d4rsua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rsua_ b.22.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vnpaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlgg
vgcplglastithglykrtprypeelellvsqqspcgratsssrvwwdssflggvvhlea
geevvvrvlderlvrlrdgtrsyfgafmv
Timeline for d4rsua_: