Lineage for d4rsuc_ (4rsu C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2041369Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2041370Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2041661Family b.22.1.0: automated matches [191519] (1 protein)
    not a true family
  6. 2041662Protein automated matches [190873] (4 species)
    not a true protein
  7. 2041663Species Human (Homo sapiens) [TaxId:9606] [188225] (28 PDB entries)
  8. 2041686Domain d4rsuc_: 4rsu C: [309542]
    Other proteins in same PDB: d4rsud1, d4rsud2, d4rsud3, d4rsue1, d4rsue2, d4rsue3, d4rsuf1, d4rsuf2, d4rsuf3, d4rsuj1, d4rsuj2, d4rsuj3, d4rsuk1, d4rsuk2, d4rsuk3, d4rsul1, d4rsul2
    automated match to d2re9a_
    complexed with cl, gol, nag

Details for d4rsuc_

PDB Entry: 4rsu (more details), 2.3 Å

PDB Description: Crystal structure of the light and hvem complex
PDB Compounds: (C:) Tumor necrosis factor ligand superfamily member 14, soluble form

SCOPe Domain Sequences for d4rsuc_:

Sequence, based on SEQRES records: (download)

>d4rsuc_ b.22.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vnpaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlgg
vgcplglastithglykrtprypeelellvsqqspcgratsssrvwwdssflggvvhlea
geevvvrvlderlvrlrdgtrsyfgafmv

Sequence, based on observed residues (ATOM records): (download)

>d4rsuc_ b.22.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vnpaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlgg
vgctithglykrtprypeelellvsqqspcssrvwwdssflggvvhleageevvvrvlde
rlvrlrdgtrsyfgafmv

SCOPe Domain Coordinates for d4rsuc_:

Click to download the PDB-style file with coordinates for d4rsuc_.
(The format of our PDB-style files is described here.)

Timeline for d4rsuc_:

  • d4rsuc_ is new in SCOPe 2.06-stable