Lineage for d4rsug_ (4rsu G:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777598Family b.22.1.0: automated matches [191519] (1 protein)
    not a true family
  6. 2777599Protein automated matches [190873] (4 species)
    not a true protein
  7. 2777600Species Human (Homo sapiens) [TaxId:9606] [188225] (28 PDB entries)
  8. 2777625Domain d4rsug_: 4rsu G: [309552]
    Other proteins in same PDB: d4rsud1, d4rsud2, d4rsud3, d4rsue1, d4rsue2, d4rsue3, d4rsuf1, d4rsuf2, d4rsuf3, d4rsuj1, d4rsuj2, d4rsuj3, d4rsuk1, d4rsuk2, d4rsuk3, d4rsul1, d4rsul2
    automated match to d2re9a_
    complexed with cl, gol, nag

Details for d4rsug_

PDB Entry: 4rsu (more details), 2.3 Å

PDB Description: crystal structure of the light and hvem complex
PDB Compounds: (G:) Tumor necrosis factor ligand superfamily member 14, soluble form

SCOPe Domain Sequences for d4rsug_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rsug_ b.22.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evnpaahltganssltgsggpllwetqlglaflrglsyhdgalvvtkagyyyiyskvqlg
gvgcplglastithglykrtprypeelellvsqqspcgratsssrvwwdssflggvvhle
ageevvvrvlderlvrlrdgtrsyfgafmv

SCOPe Domain Coordinates for d4rsug_:

Click to download the PDB-style file with coordinates for d4rsug_.
(The format of our PDB-style files is described here.)

Timeline for d4rsug_: