Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.110: DTD-like [69499] (1 superfamily) beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC |
Superfamily c.110.1: DTD-like [69500] (3 families) active form is a dimer |
Family c.110.1.0: automated matches [191422] (1 protein) not a true family |
Protein automated matches [190596] (6 species) not a true protein |
Species Aeropyrum pernix [TaxId:272557] [311433] (14 PDB entries) |
Domain d4rr7a_: 4rr7 A: [309491] automated match to d1y2qa_ complexed with a3s, mg |
PDB Entry: 4rr7 (more details), 1.86 Å
SCOPe Domain Sequences for d4rr7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rr7a_ c.110.1.0 (A:) automated matches {Aeropyrum pernix [TaxId: 272557]} mrllylhadrfeyktvkpalknppdppgeasfgealvvfttvedgdgpqtvmyaasdias hssrlkvttvilypyahlssrlakpmaahkrlielegalrtkfpghvhrapfgwyksfsi ackghplaelsrsfte
Timeline for d4rr7a_: