Lineage for d4rr7a_ (4rr7 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2920849Fold c.110: DTD-like [69499] (1 superfamily)
    beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC
  4. 2920850Superfamily c.110.1: DTD-like [69500] (3 families) (S)
    active form is a dimer
  5. 2920897Family c.110.1.0: automated matches [191422] (1 protein)
    not a true family
  6. 2920898Protein automated matches [190596] (6 species)
    not a true protein
  7. 2920899Species Aeropyrum pernix [TaxId:272557] [311433] (14 PDB entries)
  8. 2920907Domain d4rr7a_: 4rr7 A: [309491]
    automated match to d1y2qa_
    complexed with a3s, mg

Details for d4rr7a_

PDB Entry: 4rr7 (more details), 1.86 Å

PDB Description: n-terminal editing domain of threonyl-trna synthetase from aeropyrum pernix with l-ser3aa (snapshot 2)
PDB Compounds: (A:) Probable threonine--tRNA ligase 2

SCOPe Domain Sequences for d4rr7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rr7a_ c.110.1.0 (A:) automated matches {Aeropyrum pernix [TaxId: 272557]}
mrllylhadrfeyktvkpalknppdppgeasfgealvvfttvedgdgpqtvmyaasdias
hssrlkvttvilypyahlssrlakpmaahkrlielegalrtkfpghvhrapfgwyksfsi
ackghplaelsrsfte

SCOPe Domain Coordinates for d4rr7a_:

Click to download the PDB-style file with coordinates for d4rr7a_.
(The format of our PDB-style files is described here.)

Timeline for d4rr7a_: