PDB entry 4rr7

View 4rr7 on RCSB PDB site
Description: N-terminal editing domain of threonyl-tRNA synthetase from Aeropyrum pernix with L-Ser3AA (snapshot 2)
Class: ligase
Keywords: DTD-like fold, Proofreading, LIGASE
Deposited on 2014-11-06, released 2015-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Probable threonine--tRNA ligase 2
  Species: Aeropyrum pernix K1 [TaxId:272557]
  Gene: thrS2, APE_0117.1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9YFY3 (0-135)
  Domains in SCOPe 2.07: d4rr7a_
• Heterogens: A3S, MG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4rr7A (A:)
  mrllylhadrfeyktvkpalknppdppgeasfgealvvfttvedgdgpqtvmyaasdias
  hssrlkvttvilypyahlssrlakpmaahkrlielegalrtkfpghvhrapfgwyksfsi
  ackghplaelsrsfte