Lineage for d1y2qa_ (1y2q A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2528103Fold c.110: DTD-like [69499] (1 superfamily)
    beta(2)-(alpha-beta)2-beta(3); 3 layers, a/b/b; some topological similarity to the N-terminal domain of MinC
  4. 2528104Superfamily c.110.1: DTD-like [69500] (3 families) (S)
    active form is a dimer
  5. 2528120Family c.110.1.2: Archaea-specific editing domain of threonyl-tRNA synthetase (Pab-NTD) [310661] (2 proteins)
    Pfam PF08915
  6. 2528121Protein Threonyl-tRNA synthetase [310827] (1 species)
  7. 2528122Species Pyrococcus abyssi [TaxId:29292] [311096] (4 PDB entries)
  8. 2528124Domain d1y2qa_: 1y2q A: [303381]

Details for d1y2qa_

PDB Entry: 1y2q (more details), 1.95 Å

PDB Description: Crystal structure of the editing domain of threonyl-tRNA synthetase from Pyrococcus abyssi
PDB Compounds: (A:) threonyl-tRNA synthetase

SCOPe Domain Sequences for d1y2qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y2qa_ c.110.1.2 (A:) Threonyl-tRNA synthetase {Pyrococcus abyssi [TaxId: 29292]}
mrvllihsdyieyevkdkalknpepisedmkrgrmeevlvafisvekvdeknpeevslka
ieeiskvaeqvkaenvfvypfahlsselakpsvamdilnrvyqglkergfnvgkapfgyy
kafkisckghplaelsrtivpee

SCOPe Domain Coordinates for d1y2qa_:

Click to download the PDB-style file with coordinates for d1y2qa_.
(The format of our PDB-style files is described here.)

Timeline for d1y2qa_: