PDB entry 1y2q

View 1y2q on RCSB PDB site
Description: Crystal structure of the editing domain of threonyl-tRNA synthetase from Pyrococcus abyssi
Class: Ligase
Keywords: beta-alpha-beta fold, editing domain, tRNA-synthetase, Ligase
Deposited on 2004-11-23, released 2005-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.209
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: threonyl-tRNA synthetase
  Species: Pyrococcus abyssi [TaxId:29292]
  Gene: thrS
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UZ14 (0-142)
  Domains in SCOPe 2.07: d1y2qa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1y2qA (A:)
  mrvllihsdyieyevkdkalknpepisedmkrgrmeevlvafisvekvdeknpeevslka
  ieeiskvaeqvkaenvfvypfahlsselakpsvamdilnrvyqglkergfnvgkapfgyy
  kafkisckghplaelsrtivpee