Lineage for d1ft8b1 (1ft8 B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21460Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies)
  4. 21488Superfamily c.10.2: L domain-like [52058] (5 families) (S)
  5. 21498Family c.10.2.3: mRNA export factor tap [52065] (1 protein)
    this is a repeat family; one repeat unit is 1fo1 A:248-278 found in domain
  6. 21499Protein mRNA export factor tap [52066] (1 species)
  7. 21500Species Human (Homo sapiens) [TaxId:9606] [52067] (2 PDB entries)
  8. 21504Domain d1ft8b1: 1ft8 B: [30872]
    Other proteins in same PDB: d1ft8a2, d1ft8c2, d1ft8e1

Details for d1ft8b1

PDB Entry: 1ft8 (more details), 3.15 Å

PDB Description: crystal structure of the rna-binding domain of the mrna export factor tap

SCOP Domain Sequences for d1ft8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ft8b1 c.10.2.3 (B:) mRNA export factor tap {Human (Homo sapiens)}
elkpeqveqlklimskrydgsqqvldlkglrsdpdlvaqnidvvlnrrscmaatlriiee
nipellslnlsnnrlyrlddmssivqkapnlkilnlsgnelksereldkikglkleelwl
dgnslcdtfrdqstyisairerfpkllrldghelpppiafdveap

SCOP Domain Coordinates for d1ft8b1:

Click to download the PDB-style file with coordinates for d1ft8b1.
(The format of our PDB-style files is described here.)

Timeline for d1ft8b1: