SCOP 1.55: Domain d1ft8c2: 1ft8 C:117-198

Lineage for d1ft8c2 (1ft8 C:117-198)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.58: Ferredoxin-like [54861] (36 superfamilies)

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (2 families)

5. Family d.58.7.2: Non-canonical RBD domain [54954] (1 protein)

6. Protein mRNA export factor tap [54955] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54956] (2 PDB entries)

8. Domain d1ft8c2: 1ft8 C:117-198 [39215]
   Other proteins in same PDB: d1ft8a1, d1ft8b1, d1ft8c1, d1ft8d1

Details for d1ft8c2

PDB Entry: 1ft8, 3.15 Å

PDB Description: crystal structure of the rna-binding domain of the mrna export factor tap

SCOP Domain Sequences for d1ft8c2:

Sequence; same for both SEQRES and ATOM records:

>d1ft8c2 d.58.7.2 (C:117-198) mRNA export factor tap {Human (Homo sapiens)}
knwfkitipygrkydkawllsmiqskcsvpftpiefhyentraqffvedastasalkavn
ykildrenrrisiiinssapph

Timeline for d1ft8c2:

• d1ft8c2 appears in SCOP 1.57
  
• d1ft8c2 appears in the current release, SCOPe 2.08