SCOPe 2.07: Domain d1zyma2: 1zym A:3-21,A:145-249

Lineage for d1zyma2 (1zym A:3-21,A:145-249)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.1: Phosphohistidine domain [52009] (3 families)
   contains barrel, closed, n=7, S=10

5. Family c.8.1.2: N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system [52013] (1 protein)

6. Protein N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system [52014] (1 species)
   contains 4-helical insert domain, residues 22-144

7. Species Escherichia coli [TaxId:562] [52015] (11 PDB entries)

8. Domain d1zyma2: 1zym A:3-21,A:145-249 [30705]
   Other proteins in same PDB: d1zyma1, d1zymb1

Details for d1zyma2

PDB Entry: 1zym, 2.5 Å

PDB Description: amino terminal domain of enzyme i from escherichia coli

PDB Compounds: (A:) enzyme I

SCOPe Domain Sequences for d1zyma2:

Sequence; same for both SEQRES and ATOM records:

>d1zyma2 c.8.1.2 (A:3-21,A:145-249) N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system {Escherichia coli [TaxId: 562]}
sgilaspgiafgkalllkeXkiidlsaiqdevilvaadltpsetaqlnlkkvlgfitdag
grtshtsimarslelpaivgtgsvtsqvknddylildavnnqvyvnptnevidkmravqe
qvase

Timeline for d1zyma2:

• d1zyma2 first appeared (with stable ids) in SCOP 1.55
  
• d1zyma2 appears in SCOPe 2.06
  
• d1zyma2 appears in the current release, SCOPe 2.08