Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.1: Phosphohistidine domain [52009] (3 families) contains barrel, closed, n=7, S=10 |
Family c.8.1.2: N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system [52013] (1 protein) |
Protein N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system [52014] (1 species) contains 4-helical insert domain, residues 22-144 |
Species Escherichia coli [TaxId:562] [52015] (11 PDB entries) |
Domain d1zymb2: 1zym B:2-21,B:145-249 [30706] Other proteins in same PDB: d1zyma1, d1zymb1 |
PDB Entry: 1zym (more details), 2.5 Å
SCOPe Domain Sequences for d1zymb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zymb2 c.8.1.2 (B:2-21,B:145-249) N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system {Escherichia coli [TaxId: 562]} isgilaspgiafgkalllkeXkiidlsaiqdevilvaadltpsetaqlnlkkvlgfitda ggrtshtsimarslelpaivgtgsvtsqvknddylildavnnqvyvnptnevidkmravq eqvase
Timeline for d1zymb2: