Lineage for d1zyma2 (1zym A:3-21,A:145-249)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097883Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2097884Superfamily c.8.1: Phosphohistidine domain [52009] (3 families) (S)
    contains barrel, closed, n=7, S=10
  5. 2097901Family c.8.1.2: N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system [52013] (1 protein)
  6. 2097902Protein N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system [52014] (1 species)
    contains 4-helical insert domain, residues 22-144
  7. 2097903Species Escherichia coli [TaxId:562] [52015] (11 PDB entries)
  8. 2097904Domain d1zyma2: 1zym A:3-21,A:145-249 [30705]
    Other proteins in same PDB: d1zyma1, d1zymb1

Details for d1zyma2

PDB Entry: 1zym (more details), 2.5 Å

PDB Description: amino terminal domain of enzyme i from escherichia coli
PDB Compounds: (A:) enzyme I

SCOPe Domain Sequences for d1zyma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zyma2 c.8.1.2 (A:3-21,A:145-249) N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system {Escherichia coli [TaxId: 562]}
sgilaspgiafgkalllkeXkiidlsaiqdevilvaadltpsetaqlnlkkvlgfitdag
grtshtsimarslelpaivgtgsvtsqvknddylildavnnqvyvnptnevidkmravqe
qvase

SCOPe Domain Coordinates for d1zyma2:

Click to download the PDB-style file with coordinates for d1zyma2.
(The format of our PDB-style files is described here.)

Timeline for d1zyma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zyma1