| Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
| Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies) |
Superfamily c.8.1: Phosphohistidine domain [52009] (2 families) ![]() |
| Family c.8.1.2: N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system [52013] (1 protein) |
| Protein N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system [52014] (1 species) |
| Species Escherichia coli [TaxId:562] [52015] (11 PDB entries) |
| Domain d1zyma2: 1zym A:3-21,A:145-249 [30705] Other proteins in same PDB: d1zyma1, d1zymb1 |
PDB Entry: 1zym (more details), 2.5 Å
SCOP Domain Sequences for d1zyma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zyma2 c.8.1.2 (A:3-21,A:145-249) N-terminal domain of enzyme I of the PEP:sugar phosphotransferase system {Escherichia coli}
sgilaspgiafgkalllkeXkiidlsaiqdevilvaadltpsetaqlnlkkvlgfitdag
grtshtsimarslelpaivgtgsvtsqvknddylildavnnqvyvnptnevidkmravqe
qvase
Timeline for d1zyma2: