![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) ![]() C-terminal domain is beta/alpha barrel |
![]() | Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
![]() | Protein automated matches [226983] (27 species) not a true protein |
![]() | Species Thermococcus kodakarensis [TaxId:69014] [311350] (1 PDB entry) |
![]() | Domain d3wqpf1: 3wqp F:9-135 [306819] Other proteins in same PDB: d3wqpa2, d3wqpb2, d3wqpc2, d3wqpd2, d3wqpe2, d3wqpf2, d3wqpg2, d3wqph2, d3wqpi2, d3wqpj2 automated match to d3a13d1 complexed with cap, edo, mg; mutant |
PDB Entry: 3wqp (more details), 2.25 Å
SCOPe Domain Sequences for d3wqpf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wqpf1 d.58.9.0 (F:9-135) automated matches {Thermococcus kodakarensis [TaxId: 69014]} ydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerwa dlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledlyf peklire
Timeline for d3wqpf1: