Lineage for d3wqpf1 (3wqp F:9-135)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952777Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2952998Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2952999Protein automated matches [226983] (27 species)
    not a true protein
  7. 2953303Species Thermococcus kodakarensis [TaxId:69014] [311350] (1 PDB entry)
  8. 2953304Domain d3wqpf1: 3wqp F:9-135 [306819]
    Other proteins in same PDB: d3wqpa2, d3wqpb2, d3wqpc2, d3wqpd2, d3wqpe2, d3wqpf2, d3wqpg2, d3wqph2, d3wqpi2, d3wqpj2
    automated match to d3a13d1
    complexed with cap, edo, mg; mutant

Details for d3wqpf1

PDB Entry: 3wqp (more details), 2.25 Å

PDB Description: Crystal structure of Rubisco T289D mutant from Thermococcus kodakarensis
PDB Compounds: (F:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d3wqpf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wqpf1 d.58.9.0 (F:9-135) automated matches {Thermococcus kodakarensis [TaxId: 69014]}
ydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerwa
dlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledlyf
peklire

SCOPe Domain Coordinates for d3wqpf1:

Click to download the PDB-style file with coordinates for d3wqpf1.
(The format of our PDB-style files is described here.)

Timeline for d3wqpf1: