SCOPe 2.08: Domain d3wqpf1: 3wqp F:9-135

Lineage for d3wqpf1 (3wqp F:9-135)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.0: automated matches [227234] (1 protein)
   not a true family

6. Protein automated matches [226983] (27 species)
   not a true protein

7. Species Thermococcus kodakarensis [TaxId:69014] [311350] (1 PDB entry)

8. Domain d3wqpf1: 3wqp F:9-135 [306819]
   Other proteins in same PDB: d3wqpa2, d3wqpb2, d3wqpc2, d3wqpd2, d3wqpe2, d3wqpf2, d3wqpg2, d3wqph2, d3wqpi2, d3wqpj2
   automated match to d3a13d1
   complexed with cap, edo, mg; mutant

Details for d3wqpf1

PDB Entry: 3wqp, 2.25 Å

PDB Description: Crystal structure of Rubisco T289D mutant from Thermococcus kodakarensis

PDB Compounds: (F:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d3wqpf1:

Sequence; same for both SEQRES and ATOM records:

>d3wqpf1 d.58.9.0 (F:9-135) automated matches {Thermococcus kodakarensis [TaxId: 69014]}
ydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerwa
dlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledlyf
peklire

Timeline for d3wqpf1:

• d3wqpf1 first appeared in SCOPe 2.06
  
• d3wqpf1 appears in SCOPe 2.07