Lineage for d3wqph2 (3wqp H:136-444)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2838499Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2838971Family c.1.14.0: automated matches [227297] (1 protein)
    not a true family
  6. 2838972Protein automated matches [227123] (9 species)
    not a true protein
  7. 2839001Species Pyrococcus kodakaraensis [TaxId:69014] [226763] (2 PDB entries)
  8. 2839018Domain d3wqph2: 3wqp H:136-444 [306824]
    Other proteins in same PDB: d3wqpa1, d3wqpb1, d3wqpc1, d3wqpd1, d3wqpe1, d3wqpf1, d3wqpg1, d3wqph1, d3wqpi1, d3wqpj1
    automated match to d3a13a2
    complexed with cap, edo, mg; mutant

Details for d3wqph2

PDB Entry: 3wqp (more details), 2.25 Å

PDB Description: Crystal structure of Rubisco T289D mutant from Thermococcus kodakarensis
PDB Compounds: (H:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d3wqph2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wqph2 c.1.14.0 (H:136-444) automated matches {Pyrococcus kodakaraensis [TaxId: 69014]}
fdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydllsngadymkddenlt
spwynrfeeraeimakiidkvenetgekktwfanitadllemeqrlevladlglkhamvd
vvitgwgalryirdlaadyglaihghramhaafdrnpyhgismfvlaklyrligidqlhv
gtagagkleggkwdviqnarilreshykpdendvfhleqkfysikaafptssgglhpgni
qpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgipldeyakthkelaral
ekwghvtpv

SCOPe Domain Coordinates for d3wqph2:

Click to download the PDB-style file with coordinates for d3wqph2.
(The format of our PDB-style files is described here.)

Timeline for d3wqph2: