SCOPe 2.08: Structural Classification of Proteins

PDB entry 3wqp

View 3wqp on RCSB PDB site
Description: Crystal structure of Rubisco T289D mutant from Thermococcus kodakarensis
Class: lyase
Keywords: decamer, protein-ligand complex, LYASE
Deposited on 2014-01-29, released 2015-02-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-02-04, with a file datestamp of 2015-01-30.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.222
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Ribulose bisphosphate carboxylase
Species: Thermococcus kodakarensis [TaxId:69014]
Gene: rbcL, rbc, TK2290
Database cross-references and differences (RAF-indexed):
- Uniprot O93627 (Start-443)
  - engineered mutation (288)
Domains in SCOPe 2.08: d3wqpa1, d3wqpa2
Chain 'B':
Compound: Ribulose bisphosphate carboxylase
Species: Thermococcus kodakarensis [TaxId:69014]
Gene: rbcL, rbc, TK2290
Database cross-references and differences (RAF-indexed):
- Uniprot O93627 (Start-443)
  - engineered mutation (288)
Domains in SCOPe 2.08: d3wqpb1, d3wqpb2
Chain 'C':
Compound: Ribulose bisphosphate carboxylase
Species: Thermococcus kodakarensis [TaxId:69014]
Gene: rbcL, rbc, TK2290
Database cross-references and differences (RAF-indexed):
- Uniprot O93627 (Start-443)
  - engineered mutation (288)
Domains in SCOPe 2.08: d3wqpc1, d3wqpc2
Chain 'D':
Compound: Ribulose bisphosphate carboxylase
Species: Thermococcus kodakarensis [TaxId:69014]
Gene: rbcL, rbc, TK2290
Database cross-references and differences (RAF-indexed):
- Uniprot O93627 (Start-443)
  - engineered mutation (288)
Domains in SCOPe 2.08: d3wqpd1, d3wqpd2
Chain 'E':
Compound: Ribulose bisphosphate carboxylase
Species: Thermococcus kodakarensis [TaxId:69014]
Gene: rbcL, rbc, TK2290
Database cross-references and differences (RAF-indexed):
- Uniprot O93627 (Start-443)
  - engineered mutation (288)
Domains in SCOPe 2.08: d3wqpe1, d3wqpe2
Chain 'F':
Compound: Ribulose bisphosphate carboxylase
Species: Thermococcus kodakarensis [TaxId:69014]
Gene: rbcL, rbc, TK2290
Database cross-references and differences (RAF-indexed):
- Uniprot O93627 (Start-443)
  - engineered mutation (288)
Domains in SCOPe 2.08: d3wqpf1, d3wqpf2
Chain 'G':
Compound: Ribulose bisphosphate carboxylase
Species: Thermococcus kodakarensis [TaxId:69014]
Gene: rbcL, rbc, TK2290
Database cross-references and differences (RAF-indexed):
- Uniprot O93627 (Start-443)
  - engineered mutation (288)
Domains in SCOPe 2.08: d3wqpg1, d3wqpg2
Chain 'H':
Compound: Ribulose bisphosphate carboxylase
Species: Thermococcus kodakarensis [TaxId:69014]
Gene: rbcL, rbc, TK2290
Database cross-references and differences (RAF-indexed):
- Uniprot O93627 (Start-443)
  - engineered mutation (288)
Domains in SCOPe 2.08: d3wqph1, d3wqph2
Chain 'I':
Compound: Ribulose bisphosphate carboxylase
Species: Thermococcus kodakarensis [TaxId:69014]
Gene: rbcL, rbc, TK2290
Database cross-references and differences (RAF-indexed):
- Uniprot O93627 (Start-443)
  - engineered mutation (288)
Domains in SCOPe 2.08: d3wqpi1, d3wqpi2
Chain 'J':
Compound: Ribulose bisphosphate carboxylase
Species: Thermococcus kodakarensis [TaxId:69014]
Gene: rbcL, rbc, TK2290
Database cross-references and differences (RAF-indexed):
- Uniprot O93627 (Start-443)
  - engineered mutation (288)
Domains in SCOPe 2.08: d3wqpj1, d3wqpj2
Heterogens: MG, CAP, EDO, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3wqpA (A:)
mvekfdtiydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlyp
wyeqerwadlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkg
lrledlyfpeklirefdgpafgiegvrkmleikdrpiygvvpkpkvgyspeefeklaydl
lsngadymkddenltspwynrfeeraeimakiidkvenetgekktwfanitadllemeqr
levladlglkhamvdvvitgwgalryirdlaadyglaihghramhaafdrnpyhgismfv
laklyrligidqlhvgtagagkleggkwdviqnarilreshykpdendvfhleqkfysik
aafptssgglhpgniqpviealgtdivlqlgggtlghpdgpaagaravrqaidaimqgip
ldeyakthkelaralekwghvtpv