| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) ![]() C-terminal domain is beta/alpha barrel |
| Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
| Protein automated matches [226983] (27 species) not a true protein |
| Species Pyrococcus kodakaraensis [TaxId:69014] [225861] (2 PDB entries) |
| Domain d3wqpa1: 3wqp A:8-135 [306809] Other proteins in same PDB: d3wqpa2, d3wqpb2, d3wqpc2, d3wqpd2, d3wqpe2, d3wqpf2, d3wqpg2, d3wqph2, d3wqpi2, d3wqpj2 automated match to d3a13d1 complexed with cap, edo, mg; mutant |
PDB Entry: 3wqp (more details), 2.25 Å
SCOPe Domain Sequences for d3wqpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wqpa1 d.58.9.0 (A:8-135) automated matches {Pyrococcus kodakaraensis [TaxId: 69014]}
iydyyvdkgyepskkrdiiavfrvtpaegytieqaagavaaesstgtwttlypwyeqerw
adlsakaydfhdmgdgswivriaypfhafeeanlpgllasiagnifgmkrvkglrledly
fpeklire
Timeline for d3wqpa1: