Lineage for d1e0da1 (1e0d A:1-93)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21197Fold c.5: N-terminal domain of MurD (UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase) [51983] (1 superfamily)
  4. 21198Superfamily c.5.1: N-terminal domain of MurD (UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase) [51984] (1 family) (S)
  5. 21199Family c.5.1.1: N-terminal domain of MurD (UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase) [51985] (1 protein)
  6. 21200Protein N-terminal domain of MurD (UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase) [51986] (1 species)
  7. 21201Species Escherichia coli [TaxId:562] [51987] (6 PDB entries)
  8. 21207Domain d1e0da1: 1e0d A:1-93 [30655]
    Other proteins in same PDB: d1e0da2, d1e0da3

Details for d1e0da1

PDB Entry: 1e0d (more details), 2.4 Å

PDB Description: udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase

SCOP Domain Sequences for d1e0da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0da1 c.5.1.1 (A:1-93) N-terminal domain of MurD (UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase) {Escherichia coli}
adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
wlmaadlivaspgialahpslsaaadagieivg

SCOP Domain Coordinates for d1e0da1:

Click to download the PDB-style file with coordinates for d1e0da1.
(The format of our PDB-style files is described here.)

Timeline for d1e0da1: