Lineage for d1e0da1 (1e0d A:1-93)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67513Fold c.5: UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD, N-terminal domain [51983] (1 superfamily)
  4. 67514Superfamily c.5.1: UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD, N-terminal domain [51984] (1 family) (S)
  5. 67515Family c.5.1.1: UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD, N-terminal domain [51985] (1 protein)
  6. 67516Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD, N-terminal domain [51986] (1 species)
  7. 67517Species Escherichia coli [TaxId:562] [51987] (6 PDB entries)
  8. 67523Domain d1e0da1: 1e0d A:1-93 [30655]
    Other proteins in same PDB: d1e0da2, d1e0da3

Details for d1e0da1

PDB Entry: 1e0d (more details), 2.4 Å

PDB Description: udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase

SCOP Domain Sequences for d1e0da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0da1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD, N-terminal domain {Escherichia coli}
adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
wlmaadlivaspgialahpslsaaadagieivg

SCOP Domain Coordinates for d1e0da1:

Click to download the PDB-style file with coordinates for d1e0da1.
(The format of our PDB-style files is described here.)

Timeline for d1e0da1: