Lineage for d3sqka1 (3sqk A:1-185)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2865685Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2866233Protein automated matches [190087] (15 species)
    not a true protein
  7. 2866237Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [311340] (1 PDB entry)
  8. 2866238Domain d3sqka1: 3sqk A:1-185 [306511]
    Other proteins in same PDB: d3sqka2, d3sqkb2
    automated match to d4f4jb_
    complexed with so4; mutant

Details for d3sqka1

PDB Entry: 3sqk (more details), 2.45 Å

PDB Description: Conversion of the enzyme guanylate kinase into a mitotic-spindle orienting protein by a single mutation that inhibits GMP-induced closing
PDB Compounds: (A:) Guanylate kinase

SCOPe Domain Sequences for d3sqka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sqka1 c.37.1.1 (A:1-185) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
msrpivisgpsgtgkstllkklfaeypdsfgfsvpsttrtpragevngkdynfvsvdefk
smiknnefiewaqfsgnyygstvasvkqvsksgktcildidmqgvksvkaipelnarflf
iappsvedlkkrlegrgteteesinkrlsaaqaelayaetgahdkvivnddldkaykelk
dfifa

SCOPe Domain Coordinates for d3sqka1:

Click to download the PDB-style file with coordinates for d3sqka1.
(The format of our PDB-style files is described here.)

Timeline for d3sqka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3sqka2