![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
![]() | Protein automated matches [190087] (15 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [311340] (1 PDB entry) |
![]() | Domain d3sqka1: 3sqk A:1-185 [306511] Other proteins in same PDB: d3sqka2, d3sqkb2 automated match to d4f4jb_ complexed with so4; mutant |
PDB Entry: 3sqk (more details), 2.45 Å
SCOPe Domain Sequences for d3sqka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sqka1 c.37.1.1 (A:1-185) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} msrpivisgpsgtgkstllkklfaeypdsfgfsvpsttrtpragevngkdynfvsvdefk smiknnefiewaqfsgnyygstvasvkqvsksgktcildidmqgvksvkaipelnarflf iappsvedlkkrlegrgteteesinkrlsaaqaelayaetgahdkvivnddldkaykelk dfifa
Timeline for d3sqka1: